| Identification |
|---|
| HMDB Protein ID
| CDBP05653 |
| Secondary Accession Numbers
| Not Available |
| Name
| Caspase-9 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| CASP9 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| SH3 domain binding |
| Specific Function
| Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to Apaf-1 leads to activation of the protease which then cleaves and activates caspase-3. Promotes DNA damage-induced apoptosis in a ABL1/c-Abl-dependent manner. Proteolytically cleaves poly(ADP-ribose) polymerase (PARP).Isoform 2 lacks activity is an dominant-negative inhibitor of caspase-9. |
| GO Classification
|
| Biological Process |
| response to estradiol stimulus |
| extrinsic apoptotic signaling pathway in absence of ligand |
| cellular response to dexamethasone stimulus |
| glial cell apoptotic process |
| intrinsic apoptotic signaling pathway in response to DNA damage |
| leukocyte apoptotic process |
| positive regulation of neuron apoptotic process |
| platelet formation |
| response to cobalt ion |
| activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c |
| positive regulation of apoptotic process |
| activation of cysteine-type endopeptidase activity involved in apoptotic process |
| regulation of response to DNA damage stimulus |
| apoptotic process |
| response to ischemia |
| response to lipopolysaccharide |
| signal transduction in response to DNA damage |
| response to DNA damage stimulus |
| cellular response to UV |
| response to antibiotic |
| aging |
| kidney development |
| Cellular Component |
| cytosol |
| apoptosome |
| cytoplasm |
| protein-containing complex |
| mitochondrion |
| nucleus |
| Molecular Function |
| cysteine-type endopeptidase activity involved in apoptotic signaling pathway |
| protein kinase binding |
| peptidase activity |
| enzyme activator activity |
| SH3 domain binding |
| identical protein binding |
| cysteine-type endopeptidase activity |
| cysteine-type endopeptidase activity involved in apoptotic process |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1p36.21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 416 |
| Molecular Weight
| 46280.325 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Caspase-9
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P55211 |
| UniProtKB/Swiss-Prot Entry Name
| CASP9_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1511 |
| References |
|---|
| General References
| Not Available |