| Identification |
| HMDB Protein ID
| CDBP05647 |
| Secondary Accession Numbers
| Not Available |
| Name
| Taste receptor type 2 member 43 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| TAS2R43 |
| Protein Type
| Receptor |
| Biological Properties |
| General Function
| taste receptor activity |
| Specific Function
| Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. May act as chemosensory receptors in airway epithelial cells to detect and eliminate potential noxious agents from the airways (By similarity). |
| GO Classification
|
| Biological Process |
| G-protein coupled receptor signaling pathway |
| detection of chemical stimulus involved in sensory perception of bitter taste |
| Cellular Component |
| integral to membrane |
| ciliary membrane |
| plasma membrane |
| motile cilium |
| Molecular Function |
| bitter taste receptor activity |
| G protein-coupled receptor activity |
| taste receptor activity |
|
| Cellular Location
|
- Membrane
- Cell projection
- cilium membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 309 |
| Molecular Weight
| 35598.52 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
- ["2-22", "47-67", "87-107", "127-147", "179-199", "230-250", "260-280"]
|
| Protein Sequence
|
>Taste receptor type 2 member 43
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH
LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT
MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI
YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW
VKGEKTSSP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P59537 |
| UniProtKB/Swiss-Prot Entry Name
| T2R43_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18875 |
| References |
| General References
| Not Available |