| Identification |
| HMDB Protein ID
| CDBP05643 |
| Secondary Accession Numbers
| Not Available |
| Name
| Taste receptor type 2 member 42 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| TAS2R42 |
| Protein Type
| Receptor |
| Biological Properties |
| General Function
| G protein-coupled receptor activity |
| Specific Function
| Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). |
| GO Classification
|
| Biological Process |
| G-protein coupled receptor signaling pathway |
| detection of chemical stimulus involved in sensory perception of bitter taste |
| Cellular Component |
| plasma membrane |
| integral to membrane |
| Molecular Function |
| G protein-coupled receptor activity |
|
| Cellular Location
|
- Membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 36194.015 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
- ["8-28", "51-71", "102-122", "128-148", "188-208", "239-259", "266-286"]
|
| Protein Sequence
|
>Taste receptor type 2 member 42
MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQKVFSADFILTCLAISTIGQLL
VILFDSFLVGLASHLYTTYRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSLFL
WLRWRMNGMIVMLLILSLFLLIFDSLVLEIFIDISLNIIDKSNLTLYLDESKTLYDKLSI
LKTLLSLTSFIPFSLFLTSLLFLFLSLVRHTRNLKLSSLGSRDSSTEAHRRAMKMVMSFL
FLFIVHFFSLQVANGIFFMLWNNKYIKFVMLALNAFPSCHSFILILGNSKLRQTAVRLLW
HLRNYTKTPNALPL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7RTR8 |
| UniProtKB/Swiss-Prot Entry Name
| T2R42_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18888 |
| References |
| General References
| Not Available |