| Identification |
|---|
| HMDB Protein ID
| CDBP05641 |
| Secondary Accession Numbers
| Not Available |
| Name
| Cannabinoid receptor 2 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| CNR2 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| cannabinoid receptor activity |
| Specific Function
| Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. |
| GO Classification
|
| Biological Process |
| negative regulation of mast cell activation |
| inflammatory response |
| negative regulation of nitric-oxide synthase activity |
| response to amphetamine |
| sensory perception of pain |
| negative regulation of synaptic transmission, GABAergic |
| immune response |
| leukocyte chemotaxis |
| negative regulation of inflammatory response |
| G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger |
| response to lipopolysaccharide |
| negative regulation of action potential |
| G-protein coupled receptor signaling pathway |
| Cellular Component |
| endoplasmic reticulum |
| plasma membrane |
| dendrite |
| perikaryon |
| extrinsic to internal side of plasma membrane |
| integral to plasma membrane |
| Molecular Function |
| cannabinoid receptor activity |
|
| Cellular Location
|
- Cell membrane
- Cell projection
- dendrite
- Perikaryon
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1p36.11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 360 |
| Molecular Weight
| 39680.275 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
- ["34-59", "72-92", "105-129", "150-172", "189-214", "247-267", "280-301"]
|
| Protein Sequence
|
>Cannabinoid receptor 2
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P34972 |
| UniProtKB/Swiss-Prot Entry Name
| CNR2_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2160 |
| References |
|---|
| General References
| Not Available |