| Identification |
| HMDB Protein ID
| CDBP05631 |
| Secondary Accession Numbers
| Not Available |
| Name
| Microtubule-associated proteins 1A/1B light chain 3A |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| MAP1LC3A |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| ubiquitin protein ligase binding |
| Specific Function
| Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes) (PubMed:20713600, PubMed:24290141). While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:20713600). Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). |
| GO Classification
|
| Biological Process |
| cellular response to amino acid starvation |
| response to iron(II) ion |
| cellular response to starvation |
| response to lead ion |
| autophagosome assembly |
| autophagosome maturation |
| cellular response to copper ion |
| autophagy of mitochondrion |
| cellular response to hydrogen peroxide |
| cellular response to nitrogen starvation |
| response to morphine |
| macroautophagy |
| Cellular Component |
| autolysosome |
| autophagic vacuole membrane |
| synapse |
| late endosome |
| organelle membrane |
| microtubule |
| intracellular membrane-bounded organelle |
| autophagosome |
| cytosol |
| Molecular Function |
| phospholipid binding |
| microtubule binding |
| phosphatidylethanolamine binding |
| ubiquitin protein ligase binding |
|
| Cellular Location
|
- Cytoplasm
- Endomembrane system
- Cytoplasmic vesicle
- cytoskeleton
- autophagosome membrane
- Autophagosome
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 20 |
| Locus
| 20q11.22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 121 |
| Molecular Weight
| 14272.36 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Microtubule-associated proteins 1A/1B light chain 3A
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
F
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H492 |
| UniProtKB/Swiss-Prot Entry Name
| MLP3A_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:6838 |
| References |
| General References
| Not Available |