Showing Protein Transforming growth factor beta-1 proprotein (CDBP05623)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 compounds
Identification
HMDB Protein ID CDBP05623
Secondary Accession Numbers Not Available
Name Transforming growth factor beta-1 proprotein
Description Not Available
Synonyms Not Available
Gene Name TGFB1
Protein Type Enzyme
Biological Properties
General Function type III transforming growth factor beta receptor binding
Specific Function Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively.Required to maintain the Transforming growth factor beta-1 (TGF-beta-1) chain in a latent state during storage in extracellular matrix (PubMed:28117447). Associates non-covalently with TGF-beta-1 and regulates its activation via interaction with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS, that control activation of TGF-beta-1 (PubMed:2022183, PubMed:8617200, PubMed:8939931, PubMed:19750484, PubMed:22278742, PubMed:19651619). Interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia (Probable). Interaction with LRRC32/GARP controls activation of TGF-beta-1 on the surface of activated regulatory T-cells (Tregs) (PubMed:19750484, PubMed:22278742, PubMed:19651619). Interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-1 (PubMed:22278742, PubMed:28117447).Transforming growth factor beta-1: Multifunctional protein that regulates the growth and differentiation of various cell types and is involved in various processes, such as normal development, immune function, microglia function and responses to neurodegeneration (By similarity). Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains remain non-covalently linked rendering TGF-beta-1 inactive during storage in extracellular matrix (PubMed:29109152). At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS that control activation of TGF-beta-1 and maintain it in a latent state during storage in extracellular milieus (PubMed:2022183, PubMed:8617200, PubMed:8939931, PubMed:19750484, PubMed:22278742, PubMed:19651619). TGF-beta-1 is released from LAP by integrins (ITGAV:ITGB6 or ITGAV:ITGB8): integrin-binding to LAP stabilizes an alternative conformation of the LAP bowtie tail and results in distortion of the LAP chain and subsequent release of the active TGF-beta-1 (PubMed:22278742, PubMed:28117447). Once activated following release of LAP, TGF-beta-1 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal (PubMed:20207738). While expressed by many cells types, TGF-beta-1 only has a very localized range of action within cell environment thanks to fine regulation of its activation by Latency-associated peptide chain (LAP) and 'milieu molecules' (By similarity). Plays an important role in bone remodeling: acts as a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner (By similarity). At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development (By similarity). At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (PubMed:25310401). Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (PubMed:25893292, PubMed:29483653, PubMed:30696809). Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (PubMed:25893292, PubMed:30696809).
GO Classification
Biological Process
neural tube closure
embryonic liver development
epithelial to mesenchymal transition
positive regulation of phosphatidylinositol 3-kinase activity
positive regulation of cell proliferation
negative regulation of macrophage cytokine production
positive regulation of protein kinase B signaling cascade
transforming growth factor beta receptor signaling pathway involved in heart development
response to estradiol stimulus
extracellular matrix assembly
protein export from nucleus
positive regulation of pri-miRNA transcription by RNA polymerase II
negative regulation of fat cell differentiation
negative regulation of pri-miRNA transcription by RNA polymerase II
positive regulation of transcription from RNA polymerase II promoter
cellular response to transforming growth factor beta stimulus
extrinsic apoptotic signaling pathway
positive regulation of blood vessel endothelial cell migration
positive regulation of production of miRNAs involved in gene silencing by miRNA
chondrocyte differentiation
negative regulation of production of miRNAs involved in gene silencing by miRNA
response to cholesterol
positive regulation of MAP kinase activity
positive regulation vascular endothelial growth factor production
heart valve morphogenesis
negative regulation of mitotic cell cycle
positive regulation of protein localization to nucleus
positive regulation of protein import into nucleus
negative regulation of protein localization to plasma membrane
MAPK cascade
negative regulation of cell growth
negative regulation of gene expression
positive regulation of canonical Wnt receptor signaling pathway
lymph node development
positive regulation of ERK1 and ERK2 cascade
positive regulation of SMAD protein signal transduction
cell migration
negative regulation of skeletal muscle tissue development
protein phosphorylation
positive regulation of peptidyl-serine phosphorylation
negative regulation of cell cycle
membrane protein intracellular domain proteolysis
positive regulation of peptidyl-threonine phosphorylation
positive regulation of transcription regulatory region DNA binding
negative regulation of epithelial cell proliferation
ossification involved in bone remodeling
cytokine-mediated signaling pathway
negative regulation of myoblast differentiation
positive regulation of bone mineralization
mitotic cell cycle checkpoint
regulation of binding
receptor catabolic process
inflammatory response
pathway-restricted SMAD protein phosphorylation
positive regulation of cardiac muscle cell differentiation
vasculogenesis
epidermal growth factor receptor signaling pathway
regulation of cell proliferation
negative regulation of biomineral tissue development
cellular response to organic cyclic compound
regulation of blood vessel remodeling
positive regulation of protein secretion
positive regulation of superoxide anion generation
positive regulation of epithelial to mesenchymal transition
phosphate-containing compound metabolic process
positive regulation of chemotaxis
ATP biosynthetic process
negative regulation of blood vessel endothelial cell migration
negative regulation of protein phosphorylation
regulation of DNA binding
transforming growth factor beta receptor signaling pathway
response to wounding
positive regulation of extracellular matrix assembly
negative regulation of transforming growth factor beta receptor signaling pathway
platelet degranulation
negative regulation of cell differentiation
positive regulation of peptidyl-tyrosine phosphorylation
regulation of protein import into nucleus
negative regulation of cell proliferation
BMP signaling pathway
positive regulation of fibroblast migration
response to progesterone stimulus
negative regulation of cell-cell adhesion
hematopoietic progenitor cell differentiation
regulation of SMAD protein signal transduction
lipopolysaccharide-mediated signaling pathway
hyaluronan catabolic process
positive regulation of interleukin-17 production
positive regulation of protein dephosphorylation
negative regulation of cytolysis
positive regulation of cellular protein metabolic process
regulation of striated muscle tissue development
neural tube development
aortic valve morphogenesis
positive regulation of collagen biosynthetic process
positive regulation of isotype switching to IgA isotypes
positive regulation of cell migration
negative regulation of extracellular matrix disassembly
regulation of cell migration
regulation of transforming growth factor beta receptor signaling pathway
positive regulation of vascular permeability
cell-cell junction organization
positive regulation of protein phosphorylation
positive regulation of microglia differentiation
macrophage derived foam cell differentiation
negative regulation of gene silencing by miRNA
negative regulation of transcription, DNA-dependent
salivary gland morphogenesis
positive regulation of gene expression
positive regulation of protein complex assembly
common-partner SMAD protein phosphorylation
protein kinase B signaling cascade
positive regulation of NAD+ ADP-ribosyltransferase activity
cell cycle arrest
negative regulation of hyaluronan biosynthetic process
positive regulation of transcription, DNA-dependent
SMAD protein complex assembly
positive regulation of cell division
connective tissue replacement involved in inflammatory response wound healing
heart development
positive regulation of pathway-restricted SMAD protein phosphorylation
leukocyte migration
ventricular cardiac muscle tissue morphogenesis
SMAD protein signal transduction
Cellular Component
extracellular space
extracellular matrix
blood microparticle
collagen-containing extracellular matrix
cell surface
platelet alpha granule lumen
Golgi lumen
cytoplasm
plasma membrane
nucleus
extracellular region
Molecular Function
growth factor activity
antigen binding
enzyme binding
cytokine activity
identical protein binding
type I transforming growth factor beta receptor binding
type II transforming growth factor beta receptor binding
type III transforming growth factor beta receptor binding
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Pathways
Gene Properties
Chromosome Location 19
Locus 19q13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 390
Molecular Weight 44340.685
Theoretical pI Not Available
Pfam Domain Function
Signals
  • ["1-29"]
Transmembrane Regions Not Available
Protein Sequence 
>Transforming growth factor beta-1 proprotein
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P01137
UniProtKB/Swiss-Prot Entry Name TGFB1_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11766
References
General References Not Available