Identification
HMDB Protein ID CDBP05621
Secondary Accession Numbers Not Available
Name Suppressor of cytokine signaling 3
Description Not Available
Synonyms Not Available
Gene Name SOCS3
Protein Type Receptor
Biological Properties
General Function protein kinase inhibitor activity
Specific Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo (By similarity). Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST (By similarity).
GO Classification
Biological Process
receptor signaling pathway via JAK-STAT
branching involved in labyrinthine layer morphogenesis
negative regulation of apoptotic process
cellular response to leukemia inhibitory factor
negative regulation of inflammatory response
interleukin-6-mediated signaling pathway
negative regulation of insulin receptor signaling pathway
post-translational protein modification
negative regulation of receptor signaling pathway via JAK-STAT
regulation of interferon-gamma-mediated signaling pathway
negative regulation of tyrosine phosphorylation of STAT protein
phosphatidylinositol phosphorylation
placenta blood vessel development
cytokine-mediated signaling pathway
positive regulation of cell differentiation
regulation of growth
positive regulation of tyrosine phosphorylation of STAT protein
intracellular signal transduction
spongiotrophoblast differentiation
protein ubiquitination
trophoblast giant cell differentiation
Cellular Component
phosphatidylinositol 3-kinase complex
cytosol
Molecular Function
1-phosphatidylinositol-3-kinase regulator activity
phosphotyrosine binding
protein kinase inhibitor activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 17
Locus 17q25.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 225
Molecular Weight 24769.88
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Suppressor of cytokine signaling 3
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O14543
UniProtKB/Swiss-Prot Entry Name SOCS3_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19391
References
General References Not Available