| Identification |
|---|
| HMDB Protein ID
| CDBP05620 |
| Secondary Accession Numbers
| Not Available |
| Name
| Nuclear factor NF-kappa-B p100 subunit |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| NFKB2 |
| Protein Type
| Transcription Factor |
| Biological Properties |
|---|
| General Function
| transcription coactivator activity |
| Specific Function
| NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing. The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65. In concert with RELB, regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. |
| GO Classification
|
| Biological Process |
| regulation of transcription, DNA-dependent |
| follicular dendritic cell differentiation |
| positive regulation of type I interferon production |
| germinal center formation |
| NIK/NF-kappaB signaling |
| rhythmic process |
| spleen development |
| extracellular matrix organization |
| response to lipopolysaccharide |
| inflammatory response |
| I-kappaB kinase/NF-kappaB cascade |
| innate immune response |
| negative regulation of transcription from RNA polymerase II promoter |
| positive regulation of transcription from RNA polymerase II promoter |
| aging |
| positive regulation of NF-kappaB transcription factor activity |
| response to cytokine stimulus |
| Cellular Component |
| cytosol |
| cytoplasm |
| nucleus |
| nucleoplasm |
| nuclear chromatin |
| Bcl3/NF-kappaB2 complex |
| host cell nucleus |
| I-kappaB/NF-kappaB complex |
| Molecular Function |
| RNA polymerase II regulatory region sequence-specific DNA binding |
| sequence-specific DNA binding transcription factor activity |
| transcription coactivator activity |
| chromatin binding |
| RNA polymerase II core promoter proximal region sequence-specific DNA binding |
| DNA-binding transcription activator activity, RNA polymerase II-specific |
| DNA-binding transcription factor activity, RNA polymerase II-specific |
|
| Cellular Location
|
- Nucleus
- Cytoplasm
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q24.32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 900 |
| Molecular Weight
| 96748.355 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Nuclear factor NF-kappa-B p100 subunit
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q00653 |
| UniProtKB/Swiss-Prot Entry Name
| NFKB2_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7795 |
| References |
|---|
| General References
| Not Available |