| Identification |
|---|
| HMDB Protein ID
| CDBP05615 |
| Secondary Accession Numbers
| Not Available |
| Name
| Tumor necrosis factor receptor superfamily member 10B |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| TNFRSF10B |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| TRAIL binding |
| Specific Function
| Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:10549288). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis. |
| GO Classification
|
| Biological Process |
| negative regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| positive regulation of apoptotic process |
| regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| activation of cysteine-type endopeptidase activity involved in apoptotic process |
| response to endoplasmic reticulum stress |
| apoptotic process |
| TRAIL-activated apoptotic signaling pathway |
| leukocyte migration |
| extrinsic apoptotic signaling pathway via death domain receptors |
| activation of NF-kappaB-inducing kinase activity |
| cell surface receptor signaling pathway |
| intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress |
| regulation of apoptotic process |
| positive regulation of I-kappaB kinase/NF-kappaB cascade |
| cellular response to mechanical stimulus |
| Cellular Component |
| cell surface |
| plasma membrane |
| integral to membrane |
| Molecular Function |
| TRAIL binding |
| signaling receptor activity |
|
| Cellular Location
|
- Membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 8 |
| Locus
| 8p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 440 |
| Molecular Weight
| 47877.885 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Tumor necrosis factor receptor superfamily member 10B
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O14763 |
| UniProtKB/Swiss-Prot Entry Name
| TR10B_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11905 |
| References |
|---|
| General References
| Not Available |