| Identification |
|---|
| HMDB Protein ID
| CDBP05614 |
| Secondary Accession Numbers
| Not Available |
| Name
| C-X-C motif chemokine 2 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| CXCL2 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| CXCR chemokine receptor binding |
| Specific Function
| Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. |
| GO Classification
|
| Biological Process |
| immune response |
| cytokine-mediated signaling pathway |
| antimicrobial humoral immune response mediated by antimicrobial peptide |
| chemokine-mediated signaling pathway |
| killing of cells of other organism |
| leukocyte chemotaxis |
| response to molecule of bacterial origin |
| chemotaxis |
| G-protein coupled receptor signaling pathway |
| inflammatory response |
| neutrophil chemotaxis |
| cellular response to lipopolysaccharide |
| Cellular Component |
| extracellular region |
| extracellular space |
| Molecular Function |
| chemokine activity |
| CXCR chemokine receptor binding |
|
| Cellular Location
|
- Secreted
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 107 |
| Molecular Weight
| 11388.55 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>C-X-C motif chemokine 2
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P19875 |
| UniProtKB/Swiss-Prot Entry Name
| CXCL2_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4603 |
| References |
|---|
| General References
| Not Available |