Identification
HMDB Protein ID CDBP05611
Secondary Accession Numbers Not Available
Name Growth-regulated alpha protein
Description Not Available
Synonyms Not Available
Gene Name CXCL1
Protein Type Receptor
Biological Properties
General Function signaling receptor binding
Specific Function Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
GO Classification
Biological Process
cytokine-mediated signaling pathway
neutrophil degranulation
negative regulation of cell proliferation
intracellular signal transduction
signal transduction
chemotaxis
G-protein coupled receptor signaling pathway
inflammatory response
neutrophil chemotaxis
cellular response to lipopolysaccharide
antimicrobial humoral immune response mediated by antimicrobial peptide
nervous system development
chemokine-mediated signaling pathway
actin cytoskeleton organization
killing of cells of other organism
immune response
leukocyte chemotaxis
Cellular Component
extracellular region
extracellular space
specific granule lumen
tertiary granule lumen
Molecular Function
growth factor activity
enzyme activator activity
receptor binding
chemokine activity
CXCR chemokine receptor binding
Cellular Location
  1. Secreted
Pathways
Gene Properties
Chromosome Location 4
Locus 4q13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 107
Molecular Weight 11301.27
Theoretical pI Not Available
Pfam Domain Function
Signals
  • ["1-34"]
Transmembrane Regions Not Available
Protein Sequence
>Growth-regulated alpha protein
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P09341
UniProtKB/Swiss-Prot Entry Name GROA_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4602
References
General References Not Available