| Identification |
|---|
| HMDB Protein ID
| CDBP05591 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter 4 |
| Description
| Not Available |
| Synonyms
|
- ZnT-4
- Solute carrier family 30 member 4
|
| Gene Name
| SLC30A4 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Probably involved in zinc transport out of the cytoplasm, maybe by sequestration into an intracellular compartment.
|
| GO Classification
|
| Biological Process |
| response to zinc ion |
| response to toxin |
| lactation |
| response to vitamin A |
| regulation of sequestering of zinc ion |
| zinc ion homeostasis |
| Cellular Component |
| late endosome |
| endosome membrane |
| integral to membrane |
| cytoplasmic membrane-bounded vesicle |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 47482.24 |
| Theoretical pI
| 6.587 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|21359890|ref|NP_037441.2| zinc transporter 4 [Homo sapiens]
MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER
PVNGAHPTLQ
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O14863 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11015 |
| References |
|---|
| General References
| Not Available |