| Identification |
|---|
| HMDB Protein ID
| CDBP05590 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter 3 |
| Description
| Not Available |
| Synonyms
|
- ZnT-3
- Solute carrier family 30 member 3
|
| Gene Name
| SLC30A3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Involved in accumulation of zinc in synaptic vesicles (By similarity).
|
| GO Classification
|
| Biological Process |
| regulation of sequestering of zinc ion |
| positive regulation of transport |
| Cellular Component |
| cell junction |
| synaptic vesicle |
| late endosome |
| neuron projection |
| integral to plasma membrane |
| synaptic vesicle membrane |
| Molecular Function |
| zinc transporting ATPase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2p23.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 41944.895 |
| Theoretical pI
| 6.468 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|21361112|ref|NP_003450.2| zinc transporter 3 [Homo sapiens]
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL
PPPGLTPERL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q99726 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11014 |
| References |
|---|
| General References
| Not Available |