| Identification |
|---|
| HMDB Protein ID
| CDBP05585 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC9 |
| Description
| Not Available |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 9
- Zinc finger protein 379
- Zinc finger protein 380
- DHHC-9
- DHHC9
|
| Gene Name
| ZDHHC9 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
|
| GO Classification
|
| Cellular Component |
| Golgi apparatus |
| integral to membrane |
| Golgi membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| transferase activity, transferring acyl groups |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xq26.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 40915.225 |
| Theoretical pI
| 7.838 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|56682974|ref|NP_001008223.1| palmitoyltransferase ZDHHC9 [Homo sapiens]
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL
AVQLSPAIPV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y397 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18475 |
| References |
|---|
| General References
| Not Available |