| Identification |
|---|
| HMDB Protein ID
| CDBP05584 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable palmitoyltransferase ZDHHC8 |
| Description
| Not Available |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 8
- Zinc finger protein 378
- DHHC-8
|
| Gene Name
| ZDHHC8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase involved in glutamatergic transmission. Mediates palmitoylation of ABCA1.
|
| GO Classification
|
| Biological Process |
| behavior |
| Cellular Component |
| mitochondrion |
| cytoplasmic vesicle membrane |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| transferase activity, transferring acyl groups |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q11.21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 83171.835 |
| Theoretical pI
| 9.248 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|297206817|ref|NP_001171953.1| probable palmitoyltransferase ZDHHC8 isoform 1 [Homo sapiens]
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA
NFSMATFMDP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9ULC8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18474 |
| References |
|---|
| General References
| Not Available |