| Identification |
| HMDB Protein ID
| CDBP05583 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC7 |
| Description
| Not Available |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 7
- Zinc finger protein 370
- DHHC-7
|
| Gene Name
| ZDHHC7 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and thereby regulate their synaptic clustering and/or cell surface stability (By similarity). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors.
|
| GO Classification
|
| Biological Process |
| peptidyl-L-cysteine S-palmitoylation |
| Cellular Component |
| Golgi apparatus |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16q24.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 38916.99 |
| Theoretical pI
| 7.621 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|224493964|ref|NP_001139020.1| palmitoyltransferase ZDHHC7 isoform 1 [Homo sapiens]
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAY
ADFVVTFVML
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NXF8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18459 |
| References |
| General References
| Not Available |