| Identification |
| HMDB Protein ID
| CDBP05579 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC3 |
| Description
| Not Available |
| Synonyms
|
- Protein DHHC1
- Zinc finger DHHC domain-containing protein 3
- Zinc finger protein 373
- DHHC-3
|
| Gene Name
| ZDHHC3 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi (By similarity).
|
| GO Classification
|
| Biological Process |
| protein palmitoylation |
| protein targeting |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3p21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 34170.15 |
| Theoretical pI
| 8.183 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|206597477|ref|NP_001128651.1| palmitoyltransferase ZDHHC3 isoform 1 [Homo sapiens]
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEF
VVLFVMLIPS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NYG2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18470 |
| References |
| General References
| Not Available |