| Identification |
|---|
| HMDB Protein ID
| CDBP05578 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC2 |
| Description
| Not Available |
| Synonyms
|
- Reduced expression associated with metastasis protein
- Reduced expression in cancer protein
- Zinc finger DHHC domain-containing protein 2
- Zinc finger protein 372
- Ream
- Rec
- DHHC-2
|
| Gene Name
| ZDHHC2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase specific for GAP43 and DLG4/PSD95 (By similarity).
|
| GO Classification
|
| Biological Process |
| protein palmitoylation |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 8 |
| Locus
| 8p22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 42021.2 |
| Theoretical pI
| 8.357 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7705949|ref|NP_057437.1| palmitoyltransferase ZDHHC2 [Homo sapiens]
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH
LLFAMFVWSY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UIJ5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18469 |
| References |
|---|
| General References
| Not Available |