| Identification |
|---|
| HMDB Protein ID
| CDBP05577 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable palmitoyltransferase ZDHHC1 |
| Description
| Not Available |
| Synonyms
|
- DHHC domain-containing cysteine-rich protein 1
- Zinc finger DHHC domain-containing protein 1
- Zinc finger protein 377
- DHHC-1
|
| Gene Name
| ZDHHC1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| protein palmitoylation |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 16 |
| Locus
| 16q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 54817.74 |
| Theoretical pI
| 10.322 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|24307963|ref|NP_037436.1| probable palmitoyltransferase ZDHHC1 [Homo sapiens]
MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYL
FFAVIGFGIL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8WTX9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17916 |
| References |
|---|
| General References
| Not Available |