Showing Protein Probable palmitoyltransferase ZDHHC23 (CDBP05575)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | CDBP05575 | ||||||
Secondary Accession Numbers | Not Available | ||||||
Name | Probable palmitoyltransferase ZDHHC23 | ||||||
Description | Not Available | ||||||
Synonyms |
|
||||||
Gene Name | ZDHHC23 | ||||||
Protein Type | Enzyme | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | May be involved in NOS1 regulation and targeting to the synaptic membrane (By similarity). | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Pathways | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 3 | ||||||
Locus | 3q13.31 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 45982.48 | ||||||
Theoretical pI | 8.631 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>gi|50234886|ref|NP_775841.2| probable palmitoyltransferase ZDHHC23 [Homo sapiens] MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKS LQPETCERIM |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q8IYP9 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:28654 | ||||||
References | |||||||
General References | Not Available |