Identification
HMDB Protein ID CDBP05569
Secondary Accession Numbers Not Available
Name Palmitoyltransferase ZDHHC17
Description Not Available
Synonyms
  1. Huntingtin yeast partner H
  2. Huntingtin-interacting protein 14
  3. Huntingtin-interacting protein 3
  4. Huntingtin-interacting protein H
  5. Putative MAPK-activating protein PM11
  6. Putative NF-kappa-B-activating protein 205
  7. Zinc finger DHHC domain-containing protein 17
  8. HIP-14
  9. HIP-3
  10. DHHC-17
Gene Name ZDHHC17
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. Palmitoylates MPP1 in erythrocytes. May be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. Has transforming activity. Mediates Mg(2+) transport.
GO Classification
Biological Process
lipoprotein transport
positive regulation of I-kappaB kinase/NF-kappaB cascade
protein palmitoylation
Cellular Component
Golgi-associated vesicle membrane
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
signal transducer activity
magnesium ion transmembrane transporter activity
protein-cysteine S-palmitoleyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 12
Locus 12q21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 72639.345
Theoretical pI 7.497
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|103471993|ref|NP_056151.2| palmitoyltransferase ZDHHC17 [Homo sapiens]
MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD
IVKATQYGIY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IUH5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18412
References
General References Not Available