| Identification |
|---|
| HMDB Protein ID
| CDBP05567 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC15 |
| Description
| Not Available |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 15
- DHHC-15
|
| Gene Name
| ZDHHC15 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase specific for GAP43 and DLG4/PSD95 (By similarity).
|
| GO Classification
|
| Biological Process |
| establishment of protein localization |
| protein palmitoylation |
| synaptic vesicle maturation |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xq13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 38405.425 |
| Theoretical pI
| 8.098 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|226342941|ref|NP_001139728.1| palmitoyltransferase ZDHHC15 isoform 2 [Homo sapiens]
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFT
WTYWKSIFTL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96MV8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20342 |
| References |
|---|
| General References
| Not Available |