| Identification |
|---|
| HMDB Protein ID
| CDBP05550 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase |
| Description
| Not Available |
| Synonyms
|
- OHCU decarboxylase
- Parahox neighbor
|
| Gene Name
| PRHOXNB |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the stereoselective decarboxylation of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) to (S)-allantoin (Potential).
|
| GO Classification
|
| Biological Process |
| purine nucleobase metabolic process |
| allantoin biosynthetic process |
| urate catabolic process |
| Cellular Component |
| peroxisome |
| Molecular Function |
| carboxy-lyase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | urate degradation | Not Available | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| 13 |
| Locus
| 13q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 19129.52 |
| Theoretical pI
| 6.051 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|157743280|ref|NP_001099047.1| putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [Homo sapiens]
MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQ
EGILRCHPDL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A6NGE7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17785 |
| References |
|---|
| General References
| Not Available |