| Identification |
|---|
| HMDB Protein ID
| CDBP05545 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ubiquitin-conjugating enzyme E2 K |
| Description
| Not Available |
| Synonyms
|
- Huntingtin-interacting protein 2
- Ubiquitin carrier protein
- Ubiquitin-conjugating enzyme E2-25 kDa
- Ubiquitin-protein ligase
- HIP-2
- Ubiquitin-conjugating enzyme E2(25K)
- Ubiquitin-conjugating enzyme E2-25K
|
| Gene Name
| UBE2K |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.
|
| GO Classification
|
| Biological Process |
| protein K48-linked ubiquitination |
| ubiquitin-dependent protein catabolic process |
| Cellular Component |
| cytoplasm |
| Molecular Function |
| ATP binding |
| ubiquitin-ubiquitin ligase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein ubiquitination | Not Available | Not Available | | Ubiquitin mediated proteolysis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4p14 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 16618.01 |
| Theoretical pI
| 6.551 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|163660387|ref|NP_001104583.1| ubiquitin-conjugating enzyme E2 K isoform 3 [Homo sapiens]
MANIAVQRIKREFKEVLKSEEVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLL
SLQALLAAAE
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P61086 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4914 |
| References |
|---|
| General References
| Not Available |