| Identification |
| HMDB Protein ID
| CDBP05542 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ubiquitin-conjugating enzyme E2 Q1 |
| Description
| Not Available |
| Synonyms
|
- Protein NICE-5
- Ubiquitin carrier protein Q1
- Ubiquitin-protein ligase Q1
|
| Gene Name
| UBE2Q1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity).
|
| GO Classification
|
| Molecular Function |
| ubiquitin-protein ligase activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein ubiquitination | Not Available | Not Available | | Ubiquitin mediated proteolysis | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 46126.575 |
| Theoretical pI
| 5.091 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|31543906|ref|NP_060052.3| ubiquitin-conjugating enzyme E2 Q1 [Homo sapiens]
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR
IASACLDELS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7Z7E8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15698 |
| References |
| General References
| Not Available |