| Identification |
|---|
| HMDB Protein ID
| CDBP05538 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ubiquitin-conjugating enzyme E2Q-like protein 1 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| UBE2QL1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the covalent attachment of ubiquitin to other proteins (Potential).
|
| GO Classification
|
| Molecular Function |
| ubiquitin-protein ligase activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein ubiquitination | Not Available | Not Available | | Ubiquitin mediated proteolysis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p15.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 18337.93 |
| Theoretical pI
| 7.961 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|223555979|ref|NP_001138633.1| ubiquitin-conjugating enzyme E2Q-like protein 1 [Homo sapiens]
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD
NFPFSPPFMR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A1L167 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:37269 |
| References |
|---|
| General References
| Not Available |