| Identification |
|---|
| HMDB Protein ID
| CDBP05537 |
| Secondary Accession Numbers
| Not Available |
| Name
| Terminal uridylyltransferase 7 |
| Description
| Not Available |
| Synonyms
|
- TUTase 7
- Zinc finger CCHC domain-containing protein 6
|
| Gene Name
| ZCCHC6 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Uridylyltransferase that mediates the terminal uridylation of some specific RNAs. Not involved in uridylation of precursor let-7 (pre-let-7) miRNA. Does not play a role in replication-dependent histone mRNA degradation.
|
| GO Classification
|
| Biological Process |
| RNA 3'-end processing |
| Molecular Function |
| nucleic acid binding |
| metal ion binding |
| RNA uridylyltransferase activity |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 9 |
| Locus
| 9q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 171227.8 |
| Theoretical pI
| 6.831 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|297307111|ref|NP_001171988.1| terminal uridylyltransferase 7 isoform 1 [Homo sapiens]
MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGN
YGNTPRKGPC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5VYS8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25817 |
| References |
|---|
| General References
| Not Available |