Identification |
HMDB Protein ID
| CDBP05536 |
Secondary Accession Numbers
| Not Available |
Name
| Terminal uridylyltransferase 4 |
Description
| Not Available |
Synonyms
|
- TUTase 4
- Zinc finger CCHC domain-containing protein 11
|
Gene Name
| ZCCHC11 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. Catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. Does not bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28A and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. May also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP. Does not play a role in replication-dependent histone mRNA degradation.
|
GO Classification
|
Biological Process |
miRNA catabolic process |
pre-miRNA processing |
regulation of lipopolysaccharide-mediated signaling pathway |
RNA 3'-end processing |
cytokine production |
negative regulation of NF-kappaB transcription factor activity |
stem cell maintenance |
Cellular Component |
cytoplasm |
nucleolus |
Molecular Function |
nucleic acid binding |
metal ion binding |
RNA uridylyltransferase activity |
zinc ion binding |
|
Cellular Location
|
Not Available
|
Pathways
|
Not Available
|
Gene Properties |
Chromosome Location
| 1 |
Locus
| 1p32.3 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 185251.0 |
Theoretical pI
| 7.979 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|57863248|ref|NP_001009881.1| terminal uridylyltransferase 4 isoform a [Homo sapiens]
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQ
NDICIEKTEV
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q5TAX3 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:28981 |
References |
General References
| Not Available |