Identification
HMDB Protein ID CDBP05534
Secondary Accession Numbers Not Available
Name E3 ubiquitin/ISG15 ligase TRIM25
Description Not Available
Synonyms
  1. Estrogen-responsive finger protein
  2. RING finger protein 147
  3. Tripartite motif-containing protein 25
  4. Ubiquitin/ISG15-conjugating enzyme TRIM25
  5. Zinc finger protein 147
Gene Name TRIM25
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Functions as an ubiquitin E3 ligase and as an ISG15 E3 ligase. Involved in innate immune defense against viruses by mediating ubiquitination of DDX58. Mediates 'Lys-63'-linked polyubiquitination of the DDX58 N-terminal CARD-like region which is crucial for triggering the cytosolic signal transduction that leads to the production of interferons in response to viral infection. Promotes ISGylation of 14-3-3 sigma (SFN), an adapter protein implicated in the regulation of a large spectrum signaling pathway. Mediates estrogen action in various target organs.
GO Classification
Biological Process
negative regulation of type I interferon production
defense response to virus
innate immune response
virus-host interaction
Cellular Component
cytosol
cell junction
nucleus
Molecular Function
metal ion binding
sequence-specific DNA binding transcription factor activity
zinc ion binding
ubiquitin-protein ligase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 17
Locus 17q23.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 70972.785
Theoretical pI 8.096
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|68160937|ref|NP_005073.2| E3 ubiquitin/ISG15 ligase TRIM25 [Homo sapiens]
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q14258
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12932
References
General References Not Available