| Identification |
|---|
| HMDB Protein ID
| CDBP05532 |
| Secondary Accession Numbers
| Not Available |
| Name
| Mitochondrial thiamine pyrophosphate carrier |
| Description
| Not Available |
| Synonyms
|
- Mitochondrial uncoupling protein 1
- Solute carrier family 25 member 19
|
| Gene Name
| SLC25A19 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
|
| GO Classification
|
| Cellular Component |
| integral to membrane |
| mitochondrial inner membrane |
| Molecular Function |
| deoxynucleotide transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q25.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 35510.895 |
| Theoretical pI
| 9.56 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|186928858|ref|NP_001119593.1| mitochondrial thiamine pyrophosphate carrier [Homo sapiens]
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYH
GILQASRQIL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HC21 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:14409 |
| References |
|---|
| General References
| Not Available |