Showing Protein Probable tRNA(His) guanylyltransferase (CDBP05529)
| Identification | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05529 | |||||||||||
| Secondary Accession Numbers | Not Available | |||||||||||
| Name | Probable tRNA(His) guanylyltransferase | |||||||||||
| Description | Not Available | |||||||||||
| Synonyms |
|
|||||||||||
| Gene Name | THG1L | |||||||||||
| Protein Type | Enzyme | |||||||||||
| Biological Properties | ||||||||||||
| General Function | Not Available | |||||||||||
| Specific Function | Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis. | |||||||||||
| GO Classification |
|
|||||||||||
| Cellular Location | Not Available | |||||||||||
| Pathways | Not Available | |||||||||||
| Gene Properties | ||||||||||||
| Chromosome Location | 5 | |||||||||||
| Locus | 5q33.3 | |||||||||||
| SNPs | Not Available | |||||||||||
| Gene Sequence | Not Available | |||||||||||
| Protein Properties | ||||||||||||
| Number of Residues | Not Available | |||||||||||
| Molecular Weight | 34830.605 | |||||||||||
| Theoretical pI | 7.994 | |||||||||||
| Pfam Domain Function | ||||||||||||
| Signals | Not Available | |||||||||||
| Transmembrane Regions | Not Available | |||||||||||
| Protein Sequence |
>gi|89242148|ref|NP_060342.2| probable tRNA(His) guanylyltransferase [Homo sapiens] MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGR NFHRFAEKHN |
|||||||||||
| External Links | ||||||||||||
| GenBank ID Protein | Not Available | |||||||||||
| UniProtKB/Swiss-Prot ID | Q9NWX6 | |||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
| PDB IDs | ||||||||||||
| GenBank Gene ID | Not Available | |||||||||||
| GeneCard ID | Not Available | |||||||||||
| GenAtlas ID | Not Available | |||||||||||
| HGNC ID | HGNC:26053 | |||||||||||
| References | ||||||||||||
| General References | Not Available | |||||||||||