| Identification |
| HMDB Protein ID
| CDBP05522 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative ATP-dependent RNA helicase TDRD9 |
| Description
| Not Available |
| Synonyms
|
- Tudor domain-containing protein 9
|
| Gene Name
| TDRD9 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process (By similarity).
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| spermatogenesis |
| male meiosis |
| cell differentiation |
| DNA methylation involved in gamete generation |
| gene silencing by RNA |
| piRNA metabolic process |
| fertilization |
| Cellular Component |
| nucleus |
| piP-body |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| nucleic acid binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 14 |
| Locus
| 14q32.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 155682.175 |
| Theoretical pI
| 7.055 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|166851804|ref|NP_694591.2| putative ATP-dependent RNA helicase TDRD9 [Homo sapiens]
MLRKLTIEQINDWFTIGKTVTNVELLGAPPAFPAGAAREEVQRQDVAPGAGPAAQAPALA
QAPARPAAAF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NDG6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20122 |
| References |
| General References
| Not Available |