| Identification |
|---|
| HMDB Protein ID
| CDBP05519 |
| Secondary Accession Numbers
| Not Available |
| Name
| Speckle targeted PIP5K1A-regulated poly(A) polymerase |
| Description
| Not Available |
| Synonyms
|
- Star-PAP
- RNA-binding motif protein 21
- U6 snRNA-specific terminal uridylyltransferase 1
- RNA-binding protein 21
- U6-TUTase
|
| Gene Name
| TUT1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Poly(A) polymerase that creates the 3'-poly(A) tail of specific pre-mRNAs. Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3'UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3'UTR of pre-mRNAs. In addition to adenylyltransferase activity, also has uridylyltransferase activity. However, the ATP ratio is higher than UTP in cells, suggesting that it functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation.
|
| GO Classification
|
| Biological Process |
| mRNA polyadenylation |
| mRNA cleavage |
| snRNA processing |
| Cellular Component |
| nucleolus |
| nuclear speck |
| Molecular Function |
| metal ion binding |
| ATP binding |
| RNA uridylyltransferase activity |
| zinc ion binding |
| polynucleotide adenylyltransferase activity |
| mRNA 3'-UTR binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 98434.355 |
| Theoretical pI
| 6.436 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|226371750|ref|NP_073741.2| speckle targeted PIP5K1A-regulated poly(A) polymerase [Homo sapiens]
MSLPIGSAEVASERVELWRSGFRWWQRCLCFCRYRRVAMAAVDSDVESLPRGGFRCCLCH
VTTANRPSLD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6E5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26184 |
| References |
|---|
| General References
| Not Available |