| Identification |
|---|
| HMDB Protein ID
| CDBP05516 |
| Secondary Accession Numbers
| Not Available |
| Name
| RNA polymerase II subunit A C-terminal domain phosphatase SSU72 |
| Description
| Not Available |
| Synonyms
|
- CTD phosphatase SSU72
|
| Gene Name
| SSU72 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.
|
| GO Classification
|
| Biological Process |
| dephosphorylation of RNA polymerase II C-terminal domain |
| mRNA polyadenylation |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| CTD phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | mRNA surveillance pathway | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1p36.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 22574.305 |
| Theoretical pI
| 5.32 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7661832|ref|NP_054907.1| RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Homo sapiens]
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTT
YDQMYNDLLR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NP77 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25016 |
| References |
|---|
| General References
| Not Available |