| Identification |
|---|
| HMDB Protein ID
| CDBP05515 |
| Secondary Accession Numbers
| Not Available |
| Name
| Protein phosphatase Slingshot homolog 3 |
| Description
| Not Available |
| Synonyms
|
- SSH-like protein 3
- SSH-3L
- hSSH-3L
|
| Gene Name
| SSH3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly (By similarity).
|
| GO Classification
|
| Biological Process |
| regulation of axonogenesis |
| regulation of actin polymerization or depolymerization |
| regulation of lamellipodium assembly |
| peptidyl-tyrosine dephosphorylation |
| Cellular Component |
| cytoskeleton |
| cytoplasm |
| nucleus |
| Molecular Function |
| protein tyrosine/serine/threonine phosphatase activity |
| actin binding |
| DNA binding |
| protein tyrosine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Regulation of actin cytoskeleton | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 72995.04 |
| Theoretical pI
| 5.295 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|239582767|ref|NP_060327.3| protein phosphatase Slingshot homolog 3 [Homo sapiens]
MALVTVSRSPPGSGASTPVGPWDQAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEKAPS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TE77 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30581 |
| References |
|---|
| General References
| Not Available |