| Identification |
| HMDB Protein ID
| CDBP05514 |
| Secondary Accession Numbers
| Not Available |
| Name
| Spastin |
| Description
| Not Available |
| Synonyms
|
- Spastic paraplegia 4 protein
|
| Gene Name
| SPAST |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. May also play a role in axon growth and the formation of axonal branches.
|
| GO Classification
|
| Biological Process |
| cell cycle |
| microtubule bundle formation |
| microtubule severing |
| cytokinesis, completion of separation |
| ER to Golgi vesicle-mediated transport |
| nervous system development |
| protein homooligomerization |
| cell differentiation |
| protein hexamerization |
| cell death |
| Cellular Component |
| spindle |
| endoplasmic reticulum |
| perinuclear region of cytoplasm |
| nucleus |
| microtubule organizing center |
| cytoplasmic vesicle |
| microtubule |
| integral to membrane |
| endosome |
| Molecular Function |
| ATP binding |
| microtubule binding |
| microtubule-severing ATPase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| 2p24-p21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 67196.545 |
| Theoretical pI
| 9.648 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|11875211|ref|NP_055761.2| spastin isoform 1 [Homo sapiens]
MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVG
FALLRLVAFH
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UBP0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11233 |
| References |
| General References
| Not Available |