| Identification |
|---|
| HMDB Protein ID
| CDBP05513 |
| Secondary Accession Numbers
| Not Available |
| Name
| N-lysine methyltransferase SMYD2 |
| Description
| Not Available |
| Synonyms
|
- HSKM-B
- Histone methyltransferase SMYD2
- Lysine N-methyltransferase 3C
- SET and MYND domain-containing protein 2
|
| Gene Name
| SMYD2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.
|
| GO Classification
|
| Biological Process |
| peptidyl-lysine dimethylation |
| peptidyl-lysine monomethylation |
| negative regulation of transcription from RNA polymerase II promoter |
| regulation of DNA damage response, signal transduction by p53 class mediator |
| negative regulation of cell proliferation |
| transcription, DNA-dependent |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| RNA polymerase II core binding |
| metal ion binding |
| zinc ion binding |
| histone methyltransferase activity (H3-K36 specific) |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q32.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 49687.65 |
| Theoretical pI
| 6.716 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|188035871|ref|NP_064582.2| N-lysine methyltransferase SMYD2 [Homo sapiens]
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQ
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NRG4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20982 |
| References |
|---|
| General References
| Not Available |