| Identification |
| HMDB Protein ID
| CDBP05512 |
| Secondary Accession Numbers
| Not Available |
| Name
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 |
| Description
| Not Available |
| Synonyms
|
- ATP-dependent helicase 1
- hHEL1
|
| Gene Name
| SMARCAD1 |
| Protein Type
| Transcription Factor |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs. Required for the restoration of heterochromatin organization after replication. Acts at replication sites to facilitate the maintenance of heterochromatin by directing H3 and H4 histones deacetylation, H3 'Lys-9' trimethylation (H3K9me3) and restoration of silencing.
|
| GO Classification
|
| Biological Process |
| histone H3 deacetylation |
| chromosome separation |
| histone H4 deacetylation |
| regulation of DNA recombination |
| nucleotide metabolic process |
| DNA double-strand break processing |
| positive regulation of transcription, DNA-dependent |
| protein homooligomerization |
| ATP-dependent chromatin remodeling |
| Cellular Component |
| site of double-strand break |
| nuclear matrix |
| heterochromatin |
| nuclear replication fork |
| Molecular Function |
| ATP binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 4 |
| Locus
| 4q22-q23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 117601.555 |
| Theoretical pI
| 5.556 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|190358532|ref|NP_001121901.1| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 isoform a [Homo sapiens]
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDIT
EKTEDSSVPE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H4L7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18398 |
| References |
| General References
| Not Available |