| Identification |
|---|
| HMDB Protein ID
| CDBP05509 |
| Secondary Accession Numbers
| Not Available |
| Name
| Beta-galactoside alpha-2,6-sialyltransferase 2 |
| Description
| Not Available |
| Synonyms
|
- Alpha 2,6-ST 2
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2
- ST6Gal II
- Sialyltransferase 2
- ST6GalII
- hST6Gal II
|
| Gene Name
| ST6GAL2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of their carbohydrate groups, but it has weak or no activities toward glycoproteins and glycolipids.
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| protein glycosylation |
| oligosaccharide metabolic process |
| growth |
| Cellular Component |
| Golgi cisterna membrane |
| integral to Golgi membrane |
| integral to membrane |
| Molecular Function |
| beta-galactoside alpha-2,6-sialyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | N-Glycan biosynthesis | Not Available |  | | Other types of O-glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2q11.2-q12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 60157.39 |
| Theoretical pI
| 9.747 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|215272345|ref|NP_001135823.1| beta-galactoside alpha-2,6-sialyltransferase 2 isoform a [Homo sapiens]
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96JF0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10861 |
| References |
|---|
| General References
| Not Available |