| Identification |
|---|
| HMDB Protein ID
| CDBP05502 |
| Secondary Accession Numbers
| Not Available |
| Name
| Histone-lysine N-methyltransferase setd3 |
| Description
| Not Available |
| Synonyms
|
- SET domain-containing protein 3
|
| Gene Name
| SETD3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Histone methyltransferase that methylates 'Lys-36' of histone H3 (H3K36me). H3 'Lys-36' methylation represents a specific tag for epigenetic transcriptional activation (By similarity).
|
| GO Classification
|
| Biological Process |
| peptidyl-lysine dimethylation |
| peptidyl-lysine monomethylation |
| positive regulation of transcription, DNA-dependent |
| peptidyl-lysine trimethylation |
| transcription, DNA-dependent |
| Cellular Component |
| nucleus |
| Molecular Function |
| transcription coactivator activity |
| histone methyltransferase activity (H3-K36 specific) |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 14 |
| Locus
| 14q32.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 67256.535 |
| Theoretical pI
| 5.961 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|40068481|ref|NP_115609.2| histone-lysine N-methyltransferase setd3 isoform a [Homo sapiens]
MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKI
RKKQKGLSVT
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86TU7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20493 |
| References |
|---|
| General References
| Not Available |