| Identification |
|---|
| HMDB Protein ID
| CDBP05493 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter ZIP8 |
| Description
| Not Available |
| Synonyms
|
- BCG-induced integral membrane protein in monocyte clone 103 protein
- LIV-1 subfamily of ZIP zinc transporter 6
- Solute carrier family 39 member 8
- Zrt- and Irt-like protein 8
- LZT-Hs6
- ZIP-8
|
| Gene Name
| SLC39A8 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acts as a zinc-influx transporter.
|
| GO Classification
|
| Biological Process |
| zinc ion transport |
| transmembrane transport |
| Cellular Component |
| plasma membrane |
| organelle membrane |
| integral to membrane |
| Molecular Function |
| metal ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q22-q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 49630.175 |
| Theoretical pI
| 6.093 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|205830403|ref|NP_001128618.1| zinc transporter ZIP8 isoform a precursor [Homo sapiens]
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASR
VGVPEPGQLH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9C0K1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20862 |
| References |
|---|
| General References
| Not Available |