| Identification |
|---|
| HMDB Protein ID
| CDBP05492 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter SLC39A7 |
| Description
| Not Available |
| Synonyms
|
- Histidine-rich membrane protein Ke4
- Really interesting new gene 5 protein
- Solute carrier family 39 member 7
|
| Gene Name
| SLC39A7 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| zinc ion transport |
| transmembrane transport |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| metal ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 50117.95 |
| Theoretical pI
| 6.873 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|117553619|ref|NP_001070984.1| zinc transporter SLC39A7 precursor [Homo sapiens]
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHES
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92504 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4927 |
| References |
|---|
| General References
| Not Available |