| Identification |
|---|
| HMDB Protein ID
| CDBP05491 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter ZIP6 |
| Description
| Not Available |
| Synonyms
|
- Estrogen-regulated protein LIV-1
- Solute carrier family 39 member 6
- Zrt- and Irt-like protein 6
- ZIP-6
|
| Gene Name
| SLC39A6 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May act as a zinc-influx transporter.
|
| GO Classification
|
| Biological Process |
| zinc ion transmembrane import |
| cellular zinc ion homeostasis |
| Cellular Component |
| endoplasmic reticulum |
| lamellipodium membrane |
| integral to plasma membrane |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 18 |
| Locus
| 18q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 48605.05 |
| Theoretical pI
| 6.514 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|153252214|ref|NP_001092876.1| zinc transporter ZIP6 isoform 2 [Homo sapiens]
MGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISII
SFLSLLGVIL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q13433 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18607 |
| References |
|---|
| General References
| Not Available |