| Identification |
|---|
| HMDB Protein ID
| CDBP05489 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter ZIP4 |
| Description
| Not Available |
| Synonyms
|
- Solute carrier family 39 member 4
- Zrt- and Irt-like protein 4
- ZIP-4
|
| Gene Name
| SLC39A4 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability (By similarity).
|
| GO Classification
|
| Biological Process |
| cellular response to zinc ion starvation |
| cellular zinc ion homeostasis |
| transmembrane transport |
| Cellular Component |
| plasma membrane |
| recycling endosome membrane |
| apical plasma membrane |
| integral to membrane |
| cytoplasmic membrane-bounded vesicle |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Mineral absorption | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 8 |
| Locus
| 8q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 66161.175 |
| Theoretical pI
| 5.51 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|115430259|ref|NP_060237.2| zinc transporter ZIP4 isoform 1 [Homo sapiens]
MVDVVGLERETGPRGSPWPGLPLPSLVGPAPLLTCLCPQCLSVEDALGLGEPEGSGLPPG
PVLEARYVAR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6P5W5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17129 |
| References |
|---|
| General References
| Not Available |