| Identification |
|---|
| HMDB Protein ID
| CDBP05486 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter ZIP1 |
| Description
| Not Available |
| Synonyms
|
- Solute carrier family 39 member 1
- Zinc-iron-regulated transporter-like
- Zrt- and Irt-like protein 1
- ZIP-1
- hZIP1
|
| Gene Name
| SLC39A1 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
|
| GO Classification
|
| Biological Process |
| zinc ion transmembrane transport |
| Cellular Component |
| endoplasmic reticulum membrane |
| plasma membrane |
| integral to membrane |
| Molecular Function |
| inorganic cation transmembrane transporter activity |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 34249.215 |
| Theoretical pI
| 5.922 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|430768587|ref|NP_001258886.1| zinc transporter ZIP1 isoform a [Homo sapiens]
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHE
GSASRQKALS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NY26 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12876 |
| References |
|---|
| General References
| Not Available |