| Identification |
|---|
| HMDB Protein ID
| CDBP05484 |
| Secondary Accession Numbers
| Not Available |
| Name
| CMP-sialic acid transporter |
| Description
| Not Available |
| Synonyms
|
- CMP-SA-Tr
- CMP-Sia-Tr
- Solute carrier family 35 member A1
|
| Gene Name
| SLC35A1 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.
|
| GO Classification
|
| Biological Process |
| cellular protein modification process |
| carbohydrate metabolic process |
| Cellular Component |
| integral to plasma membrane |
| Golgi membrane |
| Molecular Function |
| CMP-N-acetylneuraminate transmembrane transporter activity |
| sugar:hydrogen symporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6q15 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 29918.335 |
| Theoretical pI
| 9.061 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|270288773|ref|NP_001161870.1| CMP-sialic acid transporter isoform b [Homo sapiens]
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSV
GILAKETGSL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P78382 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11021 |
| References |
|---|
| General References
| Not Available |