| Identification |
|---|
| HMDB Protein ID
| CDBP05482 |
| Secondary Accession Numbers
| Not Available |
| Name
| Mitochondrial coenzyme A transporter SLC25A42 |
| Description
| Not Available |
| Synonyms
|
- Solute carrier family 25 member 42
|
| Gene Name
| SLC25A42 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
|
| GO Classification
|
| Cellular Component |
| mitochondrion |
| integral to membrane |
| mitochondrial inner membrane |
| Molecular Function |
| ADP transmembrane transporter activity |
| AMP transmembrane transporter activity |
| ATP transmembrane transporter activity |
| coenzyme A transmembrane transporter activity |
| adenosine-diphosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19p13.11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 35408.725 |
| Theoretical pI
| 10.073 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|258547124|ref|NP_848621.2| mitochondrial coenzyme A transporter SLC25A42 [Homo sapiens]
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86VD7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28380 |
| References |
|---|
| General References
| Not Available |