| Identification |
|---|
| HMDB Protein ID
| CDBP05479 |
| Secondary Accession Numbers
| Not Available |
| Name
| tRNA-splicing ligase RtcB homolog |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| C22orf28 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as a RNA ligase with broad substrate specificity, and may function toward other RNAs.
|
| GO Classification
|
| Biological Process |
| substrate adhesion-dependent cell spreading |
| tRNA splicing, via endonucleolytic cleavage and ligation |
| cell-matrix adhesion |
| Cellular Component |
| cytoplasm |
| tRNA-splicing ligase complex |
| Molecular Function |
| RNA ligase (ATP) activity |
| metal ion binding |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 55209.95 |
| Theoretical pI
| 7.218 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7657015|ref|NP_055121.1| tRNA-splicing ligase RtcB homolog [Homo sapiens]
MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVG
GFLPAMKQIG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y3I0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26935 |
| References |
|---|
| General References
| Not Available |