Identification |
HMDB Protein ID
| CDBP05472 |
Secondary Accession Numbers
| Not Available |
Name
| DNA-directed RNA polymerase II subunit RPB3 |
Description
| Not Available |
Synonyms
|
- RNA polymerase II subunit 3
- RNA polymerase II subunit B3
- DNA-directed RNA polymerase II 33 kDa polypeptide
- DNA-directed RNA polymerase II subunit C
- RPB31
- RPB33
|
Gene Name
| POLR2C |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB3 is part of the core element with the central large cleft and the clamp element that moves to open and close the cleft (By similarity).
|
GO Classification
|
Biological Process |
7-methylguanosine mRNA capping |
mRNA splicing, via spliceosome |
viral reproduction |
positive regulation of viral transcription |
transcription elongation from RNA polymerase II promoter |
transcription initiation from RNA polymerase II promoter |
transcription-coupled nucleotide-excision repair |
Cellular Component |
DNA-directed RNA polymerase II, core complex |
microtubule cytoskeleton |
cytoplasm |
Molecular Function |
DNA-directed RNA polymerase activity |
DNA binding |
|
Cellular Location
|
Not Available
|
Pathways
|
Name | SMPDB/Pathwhiz | KEGG | RNA polymerase | Not Available |  | Huntington's disease | Not Available |  | Epstein-Barr virus infection | Not Available |  |
|
Gene Properties |
Chromosome Location
| 16 |
Locus
| 16q13-q21 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 31440.86 |
Theoretical pI
| 4.92 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|14702171|ref|NP_116558.1| DNA-directed RNA polymerase II subunit RPB3 [Homo sapiens]
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGL
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| P19387 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:9189 |
References |
General References
| Not Available |