Identification |
HMDB Protein ID
| CDBP05468 |
Secondary Accession Numbers
| Not Available |
Name
| DNA-directed RNA polymerases I and III subunit RPAC1 |
Description
| Not Available |
Synonyms
|
- DNA-directed RNA polymerase I subunit C
- RNA polymerases I and III subunit AC1
- AC40
- DNA-directed RNA polymerases I and III 40 kDa polypeptide
- RPA39
- RPC40
- RPA40
|
Gene Name
| POLR1C |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).
|
GO Classification
|
Biological Process |
termination of RNA polymerase III transcription |
transcription elongation from RNA polymerase III promoter |
termination of RNA polymerase I transcription |
transcription elongation from RNA polymerase I promoter |
transcription initiation from RNA polymerase I promoter |
Cellular Component |
nucleoplasm |
DNA-directed RNA polymerase I complex |
Molecular Function |
DNA-directed RNA polymerase activity |
DNA binding |
|
Cellular Location
|
Not Available
|
Pathways
|
Name | SMPDB/Pathwhiz | KEGG | RNA polymerase | Not Available |  | Cytosolic DNA-sensing pathway | Not Available |  | Epstein-Barr virus infection | Not Available |  |
|
Gene Properties |
Chromosome Location
| 6 |
Locus
| 6p21.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 39249.375 |
Theoretical pI
| 5.504 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|42560246|ref|NP_976035.1| DNA-directed RNA polymerases I and III subunit RPAC1 [Homo sapiens]
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS
LEFDMVGIDA
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| O15160 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:20194 |
References |
General References
| Not Available |